PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G27210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28467.4 Da    PI: 9.3265
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G27210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.4e-32958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  OMERI02G27210.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                     79**********************************************95 PP

2K-box105.85.4e-3576171499
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      +++++++ ++++s+++e++kLk++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke++l e+n++L++k
  OMERI02G27210.1  76 AQDSNNALSETQSWYHEMSKLKAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLGEINRQLKHK 169
                      45555778889**********************************************************************************9 PP

            K-box  98 le 99 
                      le
  OMERI02G27210.1 170 LE 171
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.84E-45278No hitNo description
SuperFamilySSF554552.49E-33279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-33323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-3084170IPR002487Transcription factor, K-box
PROSITE profilePS5129717.5586176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA  60
GITKTLERYQ HCCYNAQDSN NALSETQSWY HEMSKLKAKF EALQRTQRHL LGEDLGPLSV  120
KELQQLEKQL ECALSQARQR KTQLMMEQVE ELRRKERQLG EINRQLKHKL EVEGSTSNYR  180
AMQQASWAQG AVVENGATYV QPPPHSAAMD SEPTLQIGYP HQFVPAEANT IQRSTAPAGA  240
ENNFMLGWVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-227917010101Developmental protein SEPALLATA 3
4ox0_B2e-227917010101Developmental protein SEPALLATA 3
4ox0_C2e-227917010101Developmental protein SEPALLATA 3
4ox0_D2e-227917010101Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0691030.0AK069103.1 Oryza sativa Japonica Group cDNA clone:J023006N09, full insert sequence.
GenBankFJ6663180.0FJ666318.1 Oryza sativa Japonica Group MOSAIC FLORAL ORGANS 1 (MFO1) mRNA, complete cds.
GenBankFJ7509390.0FJ750939.1 Oryza sativa clone KCS214E02 MADS-box transcription factor 6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623947.10.0PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU390.0MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLA0A0E0CPV00.0A0A0E0CPV0_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g45770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-101AGAMOUS-like 6